PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015894512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 519aa    MW: 58923.2 Da    PI: 6.5108
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015894512.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.29.3e-1121415171374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPilk 92 
                     lv++L++cAeav+ +d++ a alL++l+ +a   g+++qR+a++f+++L+ rl +  v+ l++   + +  +++  s ++  al+l +e++P ++
  XP_015894512.1 141 LVQQLIACAEAVACRDKSFALALLSELRPNALVFGTSFQRVASCFVQGLSDRLEHeLVHPLVSVGVTAKMMNTTanSPDKDEALRLVYEICPQIQ 235
                     689***************************************************9545555554433333222235999999************* PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdi....sqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvp.fefn 179
                     f+h++aN  Ilea+ege++vH++D+++    s+G QW +L+q+La+R+    +  +lRiTgvg+    + e+lee+g+ L+ +A +l++  f+f+
  XP_015894512.1 236 FGHFIANASILEAFEGERCVHVVDLGMslglSHGYQWRNLMQSLANRTrgrVPLQRLRITGVGN----RGERLEEIGKELEVYAGSLKLGfFQFS 326
                     ************************87522226899************96444456*********....9********************736*** PP

            GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                     ++   +le+l++e+L ++ gE+l++n++l+lh + +es    +   ++Lk++ +lsPk++v+veq+++hn++ Fl rf+eal+yysa+fdsl+a 
  XP_015894512.1 327 MVEIGNLENLKPEDLGLSDGEVLVINSILHLHCVAKESKGALN---SILKMLHRLSPKLMVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAM 418
                     *9999*****************************988877777...9************************************************ PP

            GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLv 368
                     lp+ +  r+k+E++ +++ei+n+v+ceg++r+erhet+ +Wr+r+++aGF++ pl+  ++++ k  l+kv+ ++gyrv ee+g+l+lgWk++p++
  XP_015894512.1 419 LPKYDTRRAKIEQFHFAEEIKNIVSCEGQARVERHETMDQWRRRMSRAGFQQSPLK--MMTKTKQWLEKVSaFEGYRVMEEKGCLFLGWKSKPII 511
                     ******************************************************96..7889999******9*********************** PP

            GRAS 369 svSaWr 374
                     s+S+W+
  XP_015894512.1 512 SASCWK 517
                     *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.025115498IPR005202Transcription factor GRAS
PfamPF035143.2E-109141517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MMPPYSCQKT EVYIDEQKYS DPQMVLDPNL SSMAYLPSLP TLDNNNSSFC FFSSSLEETR  60
NHESQKLAPL TDYHESFESS TPFSSGRGST SGNSNSFQKL HFRDHVWAYT QRFLAVEAMD  120
MGFNEYEESV EEERSRDGMK LVQQLIACAE AVACRDKSFA LALLSELRPN ALVFGTSFQR  180
VASCFVQGLS DRLEHELVHP LVSVGVTAKM MNTTANSPDK DEALRLVYEI CPQIQFGHFI  240
ANASILEAFE GERCVHVVDL GMSLGLSHGY QWRNLMQSLA NRTRGRVPLQ RLRITGVGNR  300
GERLEEIGKE LEVYAGSLKL GFFQFSMVEI GNLENLKPED LGLSDGEVLV INSILHLHCV  360
AKESKGALNS ILKMLHRLSP KLMVLVEQDS SHNGPFFLGR FMEALHYYSA IFDSLDAMLP  420
KYDTRRAKIE QFHFAEEIKN IVSCEGQARV ERHETMDQWR RRMSRAGFQQ SPLKMMTKTK  480
QWLEKVSAFE GYRVMEEKGC LFLGWKSKPI ISASCWKSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-381415174375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015894512.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067H3B10.0A0A067H3B1_CITSI; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.19e-73RGA-like protein 3